PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011082226.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 439aa    MW: 49103.3 Da    PI: 7.8041
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011082226.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.21e-3640138199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+Ca+dC+lap fpa++ k+f n+hklFG+ n+lk+lk++p++er+++m+s+++eA++rardPv G++++i++++++l   ++el+
  XP_011082226.1  40 ACAACKYQRRRCAPDCPLAPFFPADRVKEFLNAHKLFGVGNILKILKRVPQHERHNTMRSVIFEANVRARDPVGGCHRLIRDMEERLLLCSSELD 134
                     7************************************************************************************9999988888 PP

          DUF260  96 llke 99 
                      + +
  XP_011082226.1 135 FVMK 138
                     7665 PP

2DUF26062.31.2e-19277371198
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aC +Ck+ +r C   C++a  f+ +++++  n+h+lF+   +lk+lk++p+++r++a++sl++eA++ra dPv G+ ++i+++ ++l+   +el+
  XP_011082226.1 277 ACLVCKLPKRIC---CPMAFRFCVDRKHEVLNAHRLFRGGYILKTLKTVPHHQRQNAIRSLIFEANMRAVDPVGGCQSLIRTMGKRLHFCCSELE 368
                     69********99...99*****************************************************************9999998888887 PP

          DUF260  96 llk 98 
                     l+ 
  XP_011082226.1 369 LVL 371
                     765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.02839140IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-3540135IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089113.678276374IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-16277367IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MNSPNNSPTA STKLPDLAQP PLTTPQLSNC DGPCASVGQA CAACKYQRRR CAPDCPLAPF  60
FPADRVKEFL NAHKLFGVGN ILKILKRVPQ HERHNTMRSV IFEANVRARD PVGGCHRLIR  120
DMEERLLLCS SELDFVMKKL AFYKYNLLLN DETPNSNIYD FVQNTKSERA IGVGSLLFAG  180
CSHEELIKVE MVEQFLNDKP TRLSNETEDP KPDVSVETHE SKESKESWSG FCHNYIKKAP  240
PSMILPNNSH DSDTTKLPNT DLSFTTPQVS DGAPDDACLV CKLPKRICCP MAFRFCVDRK  300
HEVLNAHRLF RGGYILKTLK TVPHHQRQNA IRSLIFEANM RAVDPVGGCQ SLIRTMGKRL  360
HFCCSELELV LEKLAFCKSQ VLQNDETPNS NTCDSIQIQN TICKQPVDVG SVLLHEGSSS  420
QVLHLAKTGF RDDVLPQPS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082226.10.0PREDICTED: uncharacterized protein LOC105165048
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA99262126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-35LOB domain-containing protein 22